top of page

CircRNA

Gene

chr20|63752685|63790790|-|3|circRNA|ZBTB46|ENST00000245663.8|4,3,2

ZBTB46

CircRNA UID

circZBTB46(4,3,2)

Open Reading Frame (ORF)

LQLLGHAPVHPQATHALAHGRAALPLRDLREEVHAARAHEAPHAESVEEATPGLPNEQPKGRYGNHVPLPAPAAGAQRAEAARRPVRRLRGRGGQGLQGAQERPAGQQPLLQDALLPGAEDVGAGHGHAPGHRHGPGLQGHHRLHVLSAPGAHQQERHRGDVSRQLPADDGHRASLPRLHQGGAGHQHQVGRLR

Peptide

ASLPRLHQGGAGHQHQVGR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page