top of page

CircRNA

Gene

chr20|63570894|63572107|—|1|ciRNA|HELZ2|NM_001037335|2

HELZ2

Open Reading Frame (ORF)

LNSARRLCLCVVRILEAGAWSRAGAHHRQNQRFPGAWSGAGAHHRQSQRLPGAWSRAGAHRRQSQRLPGAWSSAGAHHRQSQRLPGAWSRAGAHRRQSQRFPGAWSGAGAHRRQSQRLPGAWSGAGAHHRQSQRLPGAWSGAGAHRRQSQRFPGAWSGAGAHCRQSQRLPGAWSGAGAHHRQSQRLPGAWSRAGAHRRQSQRFPGAWSRAGAHHRQSQRLPGAWSRAGAHRRQSQRFPGAWSGAGAHRRQSQRFPGAWSGAGAHHRQSQRLPGAWSGAGAHHRQSQRFPGAWSGAGAHHRQSQRLPGAWSGAGAHRRQSQRFPGAWSGAGAHRRQSQRLPGSVDGGLPATC

Peptide

QSQRLPGAWSGAGAHR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page