top of page

CircRNA

Gene

chr20|62890959|62914406|-|14|circRNA|DIDO1|NM_001193369|15,14,13,12,11,10,9,8,7,6,5,4,3,2

DIDO1

CircRNA UID

circDIDO1(15,14,13,12,11,10,9,8,7,6,5,4,3,2)

Open Reading Frame (ORF)

LIRFHPATEEEEVAYISLYSYFSSRGRFGVVANNNRHVKDLYLIPLSAQDPVPSKLLPFEGPGAYSTGTASR

Peptide

LLPFEGPGAYSTGTASR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page