top of page

CircRNA

Gene

chr20|5598724|5604440|—|2|circRNA|GPCPD1|ENST00000379019.5|3,2

GPCPD1

Open Reading Frame (ORF)

LRYVEAVMLWETGILKMLWLFFQRMTQVKARHHKINPSE

Peptide

YVEAVMLWETGILK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page