top of page

CircRNA

Gene

chr20|5557944|5584322|-|14|circRNA|GPCPD1|ENST00000379019.5|19,18,17,16,15,14,13,12,11,10,9,8,7,6

GPCPD1

CircRNA UID

circGPCPD1(19,18,17,16,15,14,13,12,11,10,9,8,7,6)

Open Reading Frame (ORF)

LLRNPSYIQEAKAKGLVIFCWGDDTNDPENRRKLKELGVNGLIYDRKRNYY

Peptide

ELGVNGLIYDRK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page