top of page

CircRNA

Gene

chr20|53253498|53256571|+|1|circRNA|TSHZ2|ENST00000371497.9|2

TSHZ2

Open Reading Frame (ORF)

MKRATIKMTTAKRTSSDPRAIQSPGKGLSRIWTKRMLKRF

Peptide

AIQSPGKGLSR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page