top of page

CircRNA

Gene

chr20|48984728|49010404|+|13|circRNA|ARFGEF2|NM_006420|15,16,17,18,19,20,21,22,23,24,25,26,27

ARFGEF2

Open Reading Frame (ORF)

MAIRCIAQMVNSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTCHIVSSTRNPRGGSSFSRSRACWERQLKT

Peptide

GGSSFSR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page