top of page

CircRNA

Gene

chr20|47290186|47310204|—|5|circRNA|ZMYND8|ENST00000311275.11|7,6,5,4,3

ZMYND8

Open Reading Frame (ORF)

MRKRKCMAAQKPSWLMQSGFCTTASFIMGILALQREQPRKESSPALHILPMATRRRTHQQAPLKRKRNLAY

Peptide

CMAAQKPSWLMQSGFCTTASFIMGILALQR

ORF Found in Long-Read

false

Peptide Length

30

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page