top of page

CircRNA

Gene

chr20|47290186|47298947|—|4|circRNA|ZMYND8|ENST00000311275.11|7,6,5,4

ZMYND8

Open Reading Frame (ORF)

MYGCTEAFLADAKWILHNCIIYNGVRTKTWSVLLYEAATHHRPC

Peptide

MYGCTEAFLADAKWILHNCIIYNGVR

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page