top of page

CircRNA

Gene

chr20|47276313|47276795|-|1|circRNA|ZMYND8|ENST00000311275.11|11

ZMYND8

Open Reading Frame (ORF)

LCTRAPTWSRMLRRRPRRATSVRARSPWTSWIRAQGLGSNK

Peptide

ARSPWTSWIR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page