top of page

CircRNA

Gene

chr20|47246007|47298947|—|11|circRNA|ZMYND8|ENST00000311275.11|14,13,12,11,10,9,8,7,6,5,4

ZMYND8

Open Reading Frame (ORF)

MDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVRTKTWSVLLYEAATHHRPC

Peptide

TWSVLLYEAATHHRPC

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page