top of page

CircRNA

Gene

chr20|44916755|44919277|+|3|circRNA|PABPC1L|ENST00000217074.8|3,4,5

PABPC1L

Open Reading Frame (ORF)

LALSTLRSMRKPRRWRVTSMAPGVSALSILRPMRPHSRPSTP

Peptide

LALSTLRSMR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page