top of page

CircRNA

Gene

chr20|44503814|44506996|-|3|circRNA|SERINC3|NM_198941|8,7,6

SERINC3

CircRNA UID

circSERINC3(8,7,6)

Open Reading Frame (ORF)

LMSFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLCLLYSSFTVFHKRLLYPVNHLCRAALYILHQTRWLHRKQVLHQY

Peptide

AALYILHQTRWLHR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

riboCIRC,TranCirc

Potential Cryptic Translation

false

bottom of page