top of page

CircRNA

Gene

chr20|41473321|41484607|—|3|circRNA|CHD6|ENST00000373233.7|17,16,15

CHD6

Open Reading Frame (ORF)

MSELMGEYGETCARQPSTGSVSQIQTALSFFCAPEREAWGSISQLLIPASYLILTGTHKMTCR

Peptide

MSELMGEYGETCAR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page