top of page

CircRNA

Gene

chr20|41420507|41423700|—|2|circRNA|CHD6|ENST00000373233.7|31,30

CHD6

Open Reading Frame (ORF)

LGYRGLSPLQQPVSATANTWRGGCMASRMMNLKSRNPRLISQICSKVKPILSPWRVNPLLFHHSRLK

Peptide

GLSPLQQPVSATANTWR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page