top of page

CircRNA

Gene

chr20|38488402|38509208|+|5|circRNA|RALGAPB|NM_001282917|2,3,4,5,6

RALGAPB

Open Reading Frame (ORF)

LLRFTYGPSFPAFKVPDEDASLIPPEMDNECVAQTWFRFLHMLRCHLDCTLVARCTLSGGHCIW

Peptide

FLHMLRCHLDCTLVAR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page