top of page

CircRNA

Gene

chr20|35123889|35131783|—|3|circRNA|EDEM2|NM_001145025|8,7,6

EDEM2

Open Reading Frame (ORF)

MEAVWGAPGILQHSSGIHSGEARGLPTSARSATTLMCSLASGWPRTQASGLAWTPTLSTW

Peptide

TQASGLAWTPTLSTW

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page