top of page

CircRNA

Gene

chr20|33379460|33397084|—|7|circRNA|CDK5RAP1|ENST00000346416.6|8,7,6,5,4,3,2

CDK5RAP1

Open Reading Frame (ORF)

LKEVTLLGQNVNSFRDNSEVQFNSAVPTNLSRGFTTNYKTKQGGLRFAHLLDQVSRVDPEMRIRFTSPHPKDFPDETVGCLVPCTLYSVSSKCRGLWGGDHWPLCLGCR

Peptide

GLWGGDHWPLCLGCR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page