top of page

CircRNA

Gene

chr20|33366858|33395116|-|10|circRNA|CDK5RAP1|ENST00000473997.5|12,11,10,9,8,7,6,5,4,3

CDK5RAP1

CircRNA UID

circCDK5RAP1(12,11,10,9,8,7,6,5,4,3)

Open Reading Frame (ORF)

LKDDVPEEVKLRRLEELITIFREEATKANQTSVGCTQLVLVEGSTSRPMAAR

Peptide

ANQTSVGCTQLVLVEGSTSRPMAAR

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page