top of page

CircRNA

Gene

chr20|3213257|3218632|+|4|circRNA|ITPA|NR_052001|2,3,4,5

ITPA

CircRNA UID

circITPA(2,3,4,5)

Open Reading Frame (ORF)

LAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSMVGFLCLPVT

Peptide

TSMVGFLCLPVT

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page