top of page

CircRNA

Gene

chr20|2492698|2494044|—|3|circRNA|RP4—734P14.4|ENST00000461548.1|5,4,3

RP4-734P14.4

Open Reading Frame (ORF)

MEETESRAEESIQRSDAGELQESSLIGSWLQGNKLGFL

Peptide

SDAGELQESSLIGSWLQGNKLGFL

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

11

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page