top of page

CircRNA

Gene

chr20|21214534|21232830|+|4|circRNA|KIZ|ENST00000619574.4|6,7,8,9

KIZ

CircRNA UID

circKIZ(6,7,8,9)

Open Reading Frame (ORF)

LAAVHSRQRQLTKLLRKLVFHLVKEVLCQGNSIIEKSPYRRVWP

Peptide

EVLCQGNSIIEK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page