top of page

CircRNA

Gene

chr20|20524405|20535803|-|5|circRNA|RALGAPA2|ENST00000430436.5|24,23,22,21,20

RALGAPA2

CircRNA UID

circRALGAPA2(24,23,22,21,20)

Open Reading Frame (ORF)

LPLGLVHGIARECPSPPRVHSSPRGAAFGQSPLAGLYLQALPHKYFTEECHRRTK

Peptide

GAAFGQSPLAGLYLQALPHK

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page