top of page

CircRNA

Gene

chr20|20524405|20535803|—|5|circRNA|RALGAPA2|ENST00000430436.5|24,23,22,21,20

RALGAPA2

Open Reading Frame (ORF)

LPLGLVHGIARECPSPPRVHSSPRGAAFGQSPLAGLYLQALPHKYFTEECHRRTK

Peptide

YFTEECHRR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page