top of page

CircRNA

Gene

chr20|1452492|1455132|-|4|circRNA|NSFL1C|ENST00000461211.5|5,4,3,2

NSFL1C

Open Reading Frame (ORF)

LARVRNWAGFMLGAQREVDSRLLALPGRKVPTSWWMISLKVPKSMEL

Peptide

EVDSRLLALPGR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page