top of page

CircRNA

Gene

chr20|1452492|1455132|—|4|circRNA|NSFL1C|ENST00000461211.5|5,4,3,2

NSFL1C

Open Reading Frame (ORF)

LARVRNWAGFMLGAQREVDSRLLALPGRKVPTSWWMISLKVPKSMEL

Peptide

NWAGFMLGAQR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page