top of page

CircRNA

Gene

chr20|13717367|13766924|-|6|circRNA|ESF1|ENST00000202816.5|13,12,11,10,9,8

ESF1

CircRNA UID

circESF1(13,12,11,10,9,8)

Open Reading Frame (ORF)

MTLRWKSLGMRLIMKELQCSTGSLKRKSFWTWIFKPT

Peptide

ELQCSTGSLK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page