top of page

CircRNA

Gene

chr20|13534021|13569586|-|3|circRNA|TASP1|NM_017714|9,8,7

TASP1

CircRNA UID

circTASP1(9,8,7)

Open Reading Frame (ORF)

LDTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQLFSWRRSLQMGSRSWNTLLPS

Peptide

VGQLFSWR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page