top of page

CircRNA

Gene

chr20|13483226|13569586|—|5|circRNA|TASP1|NM_017714|11,10,9,8,7

TASP1

Open Reading Frame (ORF)

LCAPYWLENVHMLYKLRMLTKPCWRLCKTSLSLFSWRRSLQMGSRSWNTLLPS

Peptide

RSLQMGSR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page