top of page

CircRNA

Gene

chr20|1118752|1135306|+|4|circRNA|PSMF1|ENST00000333082.7|2,3,4,5

PSMF1

Open Reading Frame (ORF)

LLPPERWTHSGFLHTTHTPVGSLPDAEVAGAHGGPGGTVRIGSAGHHLQAGRARLLLALGSGDTRLLRLGCR

Peptide

IGSAGHHLQAGRAR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page