top of page

CircRNA

Gene

chr2|99412730|99464985|—|12|circRNA|REV1|ENST00000393445.7|13,12,11,10,9,8,7,6,5,4,3,2

REV1

Open Reading Frame (ORF)

MESKLASLGIKTCGDLQYMTMAKLQKEFGPKTGQMLYRFCRGLDDRPVRTEKERKSVSAEINYGIRFTQKLHHEARWMEEAS

Peptide

FTQKLHHEAR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page