top of page

CircRNA

Gene

chr2|97241265|97246071|+|3|circRNA|ANKRD36|ENST00000461153.6|69,70,71

ANKRD36

Open Reading Frame (ORF)

MMLATKLTIKKKQYLIFKPDVMLEYKTFKLSAESTVFY

Peptide

QYLIFKPDVMLEYK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page