top of page

CircRNA

Gene

chr2|97217372|97219048|+|1|ciRNA|ANKRD36|ENST00000461153.6|64

ANKRD36

Open Reading Frame (ORF)

LCTFSVIRQAIEHDECLCYTGIKPSDVLYESHAVAVSTSFYTYF

Peptide

QAIEHDECLCYTGIKPSDVLYESHAVAVSTSFYTYF

ORF Found in Long-Read

false

Peptide Length

36

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

36

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page