top of page

CircRNA

Gene

chr2|88574665|88595663|-|11|circRNA|EIF2AK3|NM_001313915|13,12,11,10,9,8,7,6,5,4,3

EIF2AK3

Open Reading Frame (ORF)

LRASSHHWNSQEWTMRTSVSQWMQHTTSRTVALQTVMWKMGLWMAMMRGTPLNFVLLKLLLM

Peptide

TSVSQWMQHTTSRTVALQTVMWK

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page