top of page

CircRNA

Gene

chr2|8770669|8788812|—|8|circRNA|KIDINS220|ENST00000496383.5|15,14,13,12,11,10,9,8

KIDINS220

Open Reading Frame (ORF)

LRANQISFNWDRLASWINLTEQWPYRTSWLILYLEETEGIPDQMTLKTIYESCHLLWWTKRRRELELGLGPQH

Peptide

TIYESCHLLWWTKR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page