top of page

CircRNA

Gene

chr2|8770669|8776892|—|2|circRNA|KIDINS220|ENST00000496383.5|15,14

KIDINS220

Open Reading Frame (ORF)

LRANQISFNWDRLASWINLTEQWPYRTSWLILYLEETEGIPDQMTLKTIYERTLTEEGRCRGPSLARCPLILQNCWLPRTGSVTSVPRP

Peptide

CPLILQNCWLPRTGSVTSVPRP

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

TRUE

Peptide Exists in PepTransDB

false

bottom of page