top of page

CircRNA

Gene

chr2|86158591|86173761|—|7|circRNA|IMMT|ENST00000254636.9|10,9,8,7,6,5,4

IMMT

Open Reading Frame (ORF)

LVVQARDDFKRELDSITPEVLPGWKGMNSVGSTKNL

Peptide

GMNSVGSTK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page