top of page

CircRNA

Gene

chr2|85846376|85863485|—|4|circRNA|ST3GAL5|ENST00000393808.7|5,4,3,2

ST3GAL5

Open Reading Frame (ORF)

MTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLQCQVSTPM

Peptide

KETLQCQVSTPM

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page