top of page

CircRNA

Gene

chr2|85349383|85351021|—|3|circRNA|RETSAT|NM_017750|5,4,3

RETSAT

Open Reading Frame (ORF)

LGALSSQRPLCRVCCWTQLGKPVESITLGVWKRAALAVLSWTRSLKGSWTGLPCPLLLTSWYWKGPMAERSTPCTVERKPTFRASRRSFHRRKLSLTSI

Peptide

LGALSSQRPLCR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page