top of page

CircRNA

Gene

chr2|74304488|74315025|—|2|circRNA|RP11—287D1.3|ENST00000451608.2|12,11

RP11-287D1.3

Open Reading Frame (ORF)

LGFQYPLTLKEKLTRRDIFQACKKSTGACGQTSHSRN

Peptide

LGFQYPLTLK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page