top of page

CircRNA

Gene

chr2|74003109|74048411|+|2|circRNA|TET3|NM_001287491|2,3

TET3

Open Reading Frame (ORF)

LAGRPKARLGGCPRPSSYCSPGRCPRSGGLFGCGRSCVLLWGP

Peptide

SGGLFGCGRSCVLLWGP

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page