top of page

CircRNA

Gene

chr2|73913484|73914871|+|2|circRNA|ACTG2|ENST00000438902.6|7,8

ACTG2

Open Reading Frame (ORF)

LREKLCETSRRSCAMWPWILRMRWPQQLPLPPWRRAMSCQMGRLSPLAMSASAALRPSSSLPLLASSWIQVMASPTMSPSMKAMPCPMPSCAWTWLAVTSRTTS

Peptide

AMSCQMGR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA,PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page