top of page

CircRNA

Gene

chr2|69849651|69861347|+|3|circRNA|GMCL1|ENST00000282570.3|8,9,10

GMCL1

CircRNA UID

circGMCL1(8,9,10)

Open Reading Frame (ORF)

LCINSSGLLCCGQNRTVRWVDVPSTCAFLEWIFKTAFDRNRCLVF

Peptide

LCINSSGLLCCGQNRTVR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page