top of page

CircRNA

Gene

chr2|69530007|69532162|—|3|circRNA|AAK1|NM_014911|8,7,6

AAK1

Open Reading Frame (ORF)

LKTSSCMTEATMSCVTLEAPPTNSRIHKLRESMQ

Peptide

TSSCMTEATMSCVTLEAPPTNSR

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page