top of page

CircRNA

Gene

chr2|69337897|69374113|-|14|circRNA|GFPT1|ENST00000357308.8|15,14,13,12,11,10,9,8,7,6,5,4,3,2

GFPT1

CircRNA UID

circGFPT1(15,14,13,12,11,10,9,8,7,6,5,4,3,2)

Open Reading Frame (ORF)

LWGSQTQLAVPYHGRQIVEFILMLVLRLVWPVQRYICLLKLPCSSNETRNPGDPNQRPSETGVQRI

Peptide

LPCSSNETRNPGDPNQRPSETGVQR

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

25

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page