top of page

CircRNA

Gene

chr2|63378385|63404657|—|3|circRNA|WDPCP|ENST00000409354.6|4,3,2

WDPCP

Open Reading Frame (ORF)

LRQALEPSMLQQDHFWIPLYWNIEIKSANMQGDSSITCSGSEFCPHRMGPTGCSLWHQTALSGVHSGALRKCRQRAHG

Peptide

QALEPSMLQQDHFWIPLYWNIEIK

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page