top of page

CircRNA

Gene

chr2|61331275|61348480|—|6|circRNA|USP34|NM_014709|20,19,18,17,16,15

USP34

Open Reading Frame (ORF)

LNMMKLFFDNLVYYIQTVREGRQKHALNPCREVLTKLPTVVKMEAVVLVAVVGIVMDLAMRLILATQASQLGALAVRYSQKTLQILKPSKRKMKTMIMVIILPKAVVVQIFGIES

Peptide

AVVVQIFGIES

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page