top of page

CircRNA

Gene

chr2|61235844|61246477|—|8|circRNA|USP34|NM_014709|57,56,55,54,53,52,51,50

USP34

Open Reading Frame (ORF)

MLQWIELLTKQFNNSQAACEVLKKSVIIQKTQRAMNMT

Peptide

QFNNSQAACEVLK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page