top of page

CircRNA

Gene

chr2|58048826|58089723|+|6|circRNA|VRK2|ENST00000435505.6|5,6,7,8,9,10

VRK2

CircRNA UID

circVRK2(5,6,7,8,9,10)

Open Reading Frame (ORF)

MKNTNFLFHFQKARFWMIWKAISGYWARRLALEDLD

Peptide

AISGYWARR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page