top of page

CircRNA

Gene

chr2|55254040|55254825|-|2|circRNA|MTIF2|ENST00000403721.5|6,5

MTIF2

CircRNA UID

circMTIF2(6,5)

Open Reading Frame (ORF)

MLITGKRHYLTNFEKLKWQQWKLEASLSTLVPFLIMYMKLY

Peptide

MLITGKR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page